| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Mepo3g07626 | ATGGAAGTCGCCGGAAGTTATCCGAATCCCGACAACATATCGCAGAAAATCGTTGACGTCGCTGCTGGTGAATCACACACTCTTCTTCTTACTGGAGATGGCAGTGTATACTGTTGGGGTAGAGGAATGTTTGGACGGCTTGGCAATGGTTCTCAAAAAGATGAACTTTCCCCAAAAAAACTCAACTTTGGAAACCCAAATGGAACTCAAGACAGTGTTAAAATAGTGGGTATTGCTGCTGGTTCTTATCACAGTCTTGCTCTTGCAGAAGATGGATCTGTTTGGTGCTGGGGTTACAATATATGTATCCTTAATATGCTTGGAGTCTTTTGA | 333 | 0.4294 | MEVAGSYPNPDNISQKIVDVAAGESHTLLLTGDGSVYCWGRGMFGRLGNGSQKDELSPKKLNFGNPNGTQDSVKIVGIAAGSYHSLALAEDGSVWCWGYNICILNMLGVF | 110 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Mepo3g07626 | 110 | ProSitePatterns | Regulator of chromosome condensation (RCC1) signature 2. | 78 | 88 | IPR000408 | - | |
| Mepo3g07626 | 110 | PRINTS | Chromosome condensation regulator RCC1 signature | 23 | 41 | IPR000408 | - | |
| Mepo3g07626 | 110 | PRINTS | Chromosome condensation regulator RCC1 signature | 87 | 108 | IPR000408 | - | |
| Mepo3g07626 | 110 | ProSiteProfiles | Regulator of chromosome condensation (RCC1) repeat profile. | 34 | 91 | IPR000408 | - | |
| Mepo3g07626 | 110 | PANTHER | BTK-BINDING PROTEIN-RELATED | 14 | 100 | - | - | |
| Mepo3g07626 | 110 | ProSitePatterns | Regulator of chromosome condensation (RCC1) signature 2. | 20 | 30 | IPR000408 | - | |
| Mepo3g07626 | 110 | SUPERFAMILY | RCC1/BLIP-II | 7 | 101 | IPR009091 | - | |
| Mepo3g07626 | 110 | Pfam | Regulator of chromosome condensation (RCC1) repeat | 33 | 88 | IPR000408 | - | |
| Mepo3g07626 | 110 | Gene3D | - | 3 | 104 | IPR009091 | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Mepo3g07626 | Mepo-Chr3 | 89568686 | 89569950 | Dispersed/Wgd |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Mepo3g07626 | - | - | pcin:129294410 | 162.925 |
| Select | Gene_1 | Chr_1 | Start_1 | End_1 | Gene_2 | Chr_2 | Start_2 | End_2 | Event_name |
|---|---|---|---|---|---|---|---|---|---|
| Mepo3g07626 | 3 | 89568686 | 89569950 | Mepo3g07626 | 3 | 89568686 | 89569950 | ECH | |
| Mepo3g07626 | 3 | 89568686 | 89569950 | Mepo4g00889 | 4 | 11526066 | 11527900 | PCT |