Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Mepo3g07451 ATGAGCAGACCAGGAGATTGGAACTGTAGGACATGCAACCACCTCAACTTTCAAAGAAGAGAATCTTGCCAGCGATGTGGGGAGTCAAGAATGACTTCTGGCTGCGGCTCCGTTGATTTTGGTGGCTCCTTTCTTGGTGGAAGAGGCTCTAGCTCCCCTTTTCCTTTCACCACCGGCCCTGATGTCCGTCCTGGTGACTGGTATTGCACTGTTGGAAACTGTGGAGCTCACAACTTTGCCAGCCGCTCCAGCTGCTTCAAATGTGGTGCCCCAAAGGATATTGATACCTTCTCCTCTGACTCCTCAGACATGCCACGATTGTTGAGATCACCATACGGTTTTGGAGGAGGCAGCGGCAGTGGTGGTGCCTCCACTCGCCCCGGCTGGAAATCCGGTGACTGGATATGCACCAGGTCTGGGTGTAACGAGCATAACTTCGCCAATAGAATGGAATGCTACCGATGCAACGGTCCAAGGGACTCTAGTACTGGAAGATCTTCCTTTTTATCGTGA 513 0.5205 MSRPGDWNCRTCNHLNFQRRESCQRCGESRMTSGCGSVDFGGSFLGGRGSSSPFPFTTGPDVRPGDWYCTVGNCGAHNFASRSSCFKCGAPKDIDTFSSDSSDMPRLLRSPYGFGGGSGSGGASTRPGWKSGDWICTRSGCNEHNFANRMECYRCNGPRDSSTGRSSFLS 170
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Mepo3g07451 170 PANTHER ZINC FINGER PROTEIN 60 162 - -
Mepo3g07451 170 SMART zf_4 5 29 IPR001876 -
Mepo3g07451 170 SMART zf_4 132 158 IPR001876 -
Mepo3g07451 170 SMART zf_4 65 91 IPR001876 -
Mepo3g07451 170 SUPERFAMILY Ran binding protein zinc finger-like 2 33 IPR036443 -
Mepo3g07451 170 SUPERFAMILY Ran binding protein zinc finger-like 59 95 IPR036443 -
Mepo3g07451 170 Gene3D - 59 94 - -
Mepo3g07451 170 Gene3D - 124 161 - -
Mepo3g07451 170 Gene3D - 2 33 - -
Mepo3g07451 170 FunFam Ran-binding zinc finger protein 57 94 - -
Mepo3g07451 170 ProSiteProfiles Zinc finger RanBP2 type profile. 3 32 IPR001876 -
Mepo3g07451 170 ProSitePatterns Zinc finger RanBP2-type signature. 7 26 IPR001876 -
Mepo3g07451 170 FunFam Ran-binding zinc finger protein 120 161 - -
Mepo3g07451 170 SUPERFAMILY Ran binding protein zinc finger-like 125 162 IPR036443 -
Mepo3g07451 170 ProSiteProfiles Zinc finger RanBP2 type profile. 63 94 IPR001876 -
Mepo3g07451 170 Pfam Zn-finger in Ran binding protein and others 130 159 IPR001876 -
Mepo3g07451 170 Pfam Zn-finger in Ran binding protein and others 3 27 IPR001876 -
Mepo3g07451 170 Pfam Zn-finger in Ran binding protein and others 63 92 IPR001876 -
Mepo3g07451 170 ProSitePatterns Zinc finger RanBP2-type signature. 67 88 IPR001876 -
Mepo3g07451 170 ProSitePatterns Zinc finger RanBP2-type signature. 134 155 IPR001876 -
Mepo3g07451 170 ProSiteProfiles Zinc finger RanBP2 type profile. 130 161 IPR001876 -
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Mepo3g07451 Mepo-Chr3 87882683 87884082 Wgd
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mepo3g07451 - - mtr:11431968 343.969
       

Event-related genes

Select Gene_1 Chr_1 Start_1 End_1 Gene_2 Chr_2 Start_2 End_2 Event_name
Mepo3g07451 3 87882683 87884082 Mepo3g07451 3 87882683 87884082 ECH