Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Mepo1g04642 ATGGCTGCTAACTATTCTTTCTCTTCTTCATCACCATCTTCTTCAATCCCTTCTCCAAAATCTAGCATGTTTTATTATGGTGGAAGTGAAGATTTCTATGATGAACCTCACTTCCTCCAAGCTTGTTATCTTTGTAGAAAACCTCTTGGCCAAAACAAAGACATCTTTATGTACAGAGGGAACACACCATTTTGTAGCAATGAGTGCAGGCAAGAACAAATAGAGATTGATGAGTCCAAAGAGAAAAGTTGGAAGATTTCTACCAAAAGAGGTGTTAGAAATTCTGAAACCAATCAGAATTCTTCAAACAATAAGGCTGTAAGATCAGAATCAGTTGCAGTGGCCTAA 348 0.3736 MAANYSFSSSSPSSSIPSPKSSMFYYGGSEDFYDEPHFLQACYLCRKPLGQNKDIFMYRGNTPFCSNECRQEQIEIDESKEKSWKISTKRGVRNSETNQNSSNNKAVRSESVAVA 115
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Mepo1g04642 115 PANTHER FCS-LIKE ZINC FINGER 1-RELATED 22 115 IPR044533 -
Mepo1g04642 115 ProSiteProfiles Zinc finger FLZ-type profile. 37 81 IPR007650 -
Mepo1g04642 115 Pfam zinc-finger of the FCS-type, C2-C2 32 80 IPR007650 -
Mepo1g04642 115 MobiDBLite consensus disorder prediction 80 115 - -
Mepo1g04642 115 MobiDBLite consensus disorder prediction 90 109 - -
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Mepo1g04642 Mepo-Chr1 54226860 54228014 Transposed
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mepo1g04642 - - psat:127076678 196.438
       

Event-related genes

Select Gene_1 Chr_1 Start_1 End_1 Gene_2 Chr_2 Start_2 End_2 Event_name
Mepo1g04642 1 54226860 54228014 Mepo1g04642 1 54226860 54228014 ECH