LGRPv2

Gene search

Sequence information

Show entries

Search:

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Trme37611g00001	ATGGCACTCATCAAGAAGCTCCGCAAGGCGAAACGTGAGGCACCAGCAGGTGAGAAGCCGGAACCAGTGAGGACTCACCTCCGTAACATGATCATCGTGCCTGAGATGATCGGTAGCATCATTGGTGTCTACAACGGAAAGACCTTCAACCAGGTTGAAATTAAACCTGAAATGATTGGTCACTATCTGGCTGAATTCTCTATCTCTTACAAGCCTGTTAAGCACGGTAGACCTGGTATTGGTGCTACTCACTC	254	0.4843	MALIKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHS	85

Showing 1 to 1 of 1 entries

Annotation information

Show entries

Search:

Select	Seq ID	Length	Analysis	Description	Start	End	IPR	GO
	Trme37611g00001	85	Hamap	30S ribosomal protein S19 [rpsS].	6	81	IPR002222	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	Gene3D	30s Ribosomal Protein S19; Chain A	1	85	IPR023575	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	NCBIfam	30S ribosomal protein S19	2	85	IPR005713	GO:0003735\|GO:0006412\|GO:0015935
	Trme37611g00001	85	FunFam	40S ribosomal protein S15	1	85	-	-
	Trme37611g00001	85	PANTHER	RIBOSOMAL PROTEIN S19P FAMILY MEMBER	1	85	IPR002222	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	ProSitePatterns	Ribosomal protein S19 signature.	45	69	IPR020934	GO:0003723
	Trme37611g00001	85	PIRSF	RPS19p_RPS19a_RPS15e_RPS19o	2	85	IPR002222	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	Pfam	Ribosomal protein S19	2	75	IPR002222	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	PRINTS	Ribosomal protein S19 family signature	57	72	IPR002222	GO:0003735\|GO:0005840\|GO:0006412
	Trme37611g00001	85	PRINTS	Ribosomal protein S19 family signature	25	44	IPR002222	GO:0003735\|GO:0005840\|GO:0006412

Showing 1 to 10 of 13 entries

Previous1 2Next

Duplication type information

Show entries

Search:

Select	Gene	Chromosome	Start	End	Duplicated_type
	Trme37611g00001	Trme-Chr37611	1	763	Dispersed

Showing 1 to 1 of 1 entries

Functional genes information

Show entries

Search:

Select	Gene	Gene_start	Gene_end	Function	Ath_gene	Identity(%)	E-value	Score
	Trme37611g00001	1	85	Cytoplasmic Ribosomal Protein Gene Family	AT5G09510	98.824	1.61e-58	173

Showing 1 to 1 of 1 entries

Pathway information

Show entries

Search:

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Trme37611g00001	K02958		-	csav:115722952	174.481

Showing 1 to 1 of 1 entries