| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Sto5g1776 | ATGGGGAAGCAACCTGTGAGGATGAAGGCCGTGGTCTATGCGCTCTCACCTTTCCAGCAGAAGGTTATGCCTGGCCTCTGGAAGGATTTGCCTACCAAGATTCACCACAAGGTCTCTGAGAATTGGATCAGCGCCACTCTCCTCCTCGGTCCTCTTGTCGGCACCTACGCGTAA | 174 | 0.546 | MGKQPVRMKAVVYALSPFQQKVMPGLWKDLPTKIHHKVSENWISATLLLGPLVGTYA | 57 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Sto5g1776 | 57 | Gene3D | - | 2 | 57 | IPR036642 | GO:0005750|GO:0006122 | |
| Sto5g1776 | 57 | PANTHER | CYTOCHROME B-C1 COMPLEX SUBUNIT 8 | 1 | 57 | IPR020101 | GO:0005750|GO:0070469 | |
| Sto5g1776 | 57 | PANTHER | CYTOCHROME B-C1 COMPLEX, SUBUNIT 8 | 1 | 57 | - | - | |
| Sto5g1776 | 57 | Pfam | Cytochrome b-c1 complex subunit 8 | 1 | 56 | IPR020101 | GO:0005750|GO:0070469 | |
| Sto5g1776 | 57 | SUPERFAMILY | Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) | 10 | 44 | IPR036642 | GO:0005750|GO:0006122 |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Sto5g1776 | Sto-Chr5 | 12860728 | 12860901 | Dispersed/Wgd |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Sto5g1776 | 1 | 56 | Chloroplast and Mitochondria Gene Families | AT3G10860 | 85.714 | 1.92e-32 | 104 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Sto5g1776 | - | - | pop:18104698 | 114.775 |