Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Seca7g05217 ATGAAGCTAGCAACTACATCCATTGACACAACAACTGATAATTTAATTCAAAAGACTATTAGGGAAGAGACAAGTGGATGCACAGTCATTACTGTGGCACATAGAATTCCTACAGTTTTTGATAATGACTTGGTTTTGGTCCTTGATCAAGGCATTTAA 159 0.3585 MKLATTSIDTTTDNLIQKTIREETSGCTVITVAHRIPTVFDNDLVLVLDQGI. 53
       

Annotation information


Select Seq ID Length Analysis Description Start End IPR GO
Seca7g05217 52 Gene3D - 4 52 IPR027417 -
Seca7g05217 52 PANTHER ATP-BINDING CASSETTE SUB-FAMILY C 4 51 - -
Seca7g05217 52 SUPERFAMILY P-loop containing nucleoside triphosphate hydrolases 4 51 IPR027417 -
       

Duplication type information


Select Gene Chromosome Start End Duplicated_type
Seca7g05217 Seca-Chr7 149931893 149932051 Transposed
       

Functional genes information


Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Seca7g05217 4 51 Calmodulin-binding Proteins AT2G36910 37.500 1.01e-06 41.2
       

Pathway information


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Seca7g05217 - - bvg:104897638 89.7373