| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Psa6g3314 | ATGTCGACCGTCGCTCAAACCAAGCCCAAGAAAACTGCTGCGGCAAAGAAGCCACTTTCTCATCCCACTTTCGCTGAGATGATAACTGAAGCAATCACAAGCCTGAAAGAAAGAACCGGTTCAAGCCAATATGCTATAACAAAATTCATCGAAGAGAAACACAAGGACTTACCTCCAACTTACCGTAAGCTTGTTCTCCTCCATCTCAAGAAATCCGTCGCTTCAGGAAAGCTTGTCAAGGTGAAAAGCTCCTTCAAACTCGCTCCGGCGGCCGCAAAAACTGCTCCGGCCAAGACATCGGCTGCTACCAAAGCTCCTAAAGCTGTTACCAAGCCAAGCGCTAAAGCTGTCACAAAGCCCAAGGCTAAAGCTGCTGGGAAGCCGAAAGCCAAAGCTGCGGCAAAGCCGAAAGCTGTTGCGAAGCCAAAGGCTAAGAGCGTGAAGGCTACTCCGGTGAAGAAGGCTGTTGCTAAGAAGGTTGTGAAGAAGGCGAAGAGCGTTAAAAGTCCGGCGAAGAAGGTGAAGAGCGTTAAAACTCCGGTGAAGAAGGCTAAGAAGTGA | 561 | 0.4938 | MSTVAQTKPKKTAAAKKPLSHPTFAEMITEAITSLKERTGSSQYAITKFIEEKHKDLPPTYRKLVLLHLKKSVASGKLVKVKSSFKLAPAAAKTAPAKTSAATKAPKAVTKPSAKAVTKPKAKAAGKPKAKAAAKPKAVAKPKAKSVKATPVKKAVAKKVVKKAKSVKSPAKKVKSVKTPVKKAKK* | 187 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Psa6g3314 | 186 | Gene3D | - | 15 | 100 | IPR036388 | - | |
| Psa6g3314 | 186 | PANTHER | HISTONE H1 | 2 | 184 | - | - | |
| Psa6g3314 | 186 | PANTHER | LINKER HISTONE H1 AND H5 FAMILY PROTEIN | 2 | 184 | - | - | |
| Psa6g3314 | 186 | Pfam | linker histone H1 and H5 family | 21 | 87 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Psa6g3314 | 186 | SUPERFAMILY | "Winged helix" DNA-binding domain | 17 | 98 | IPR036390 | - | |
| Psa6g3314 | 186 | MobiDBLite | consensus disorder prediction | 90 | 186 | - | - | |
| Psa6g3314 | 186 | PRINTS | Histone H5 signature | 7 | 28 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Psa6g3314 | 186 | PRINTS | Histone H5 signature | 34 | 51 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Psa6g3314 | 186 | PRINTS | Histone H5 signature | 115 | 129 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Psa6g3314 | 186 | PRINTS | Histone H5 signature | 147 | 164 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Psa6g3314 | 186 | PRINTS | Histone H5 signature | 169 | 186 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Psa6g3314 | 186 | MobiDBLite | consensus disorder prediction | 122 | 142 | - | - | |
| Psa6g3314 | 186 | ProSiteProfiles | Linker histone H1/H5 globular (H15) domain profile. | 20 | 89 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Psa6g3314 | 186 | CDD | H15 | 20 | 87 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Psa6g3314 | 186 | MobiDBLite | consensus disorder prediction | 155 | 186 | - | - | |
| Psa6g3314 | 186 | SMART | h15plus2 | 18 | 84 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Psa6g3314 | Psa-Chr6 | 285161570 | 285163028 | Transposed |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Psa6g3314 | 11 | 126 | Single Myb Histone (SMH) Gene Family | AT5G67580 | 32.479 | 1.47e-08 | 51.2 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Psa6g3314 | K11275 | - | gmx:100810590 | 137.117 |