| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Psa4g4717 | ATGACCATGAAAAGAGGCGAGGTAGCTTTGTTGACTATCCCGCCTGAATATGCTTTTGGTTCATCAGAGTCTCAGCGGGAACTGGCAGTGGTTCCTCCTAATTCAACCTTGTACTATGAAGTTGAGCTAGTAACATTCATAAAGGATAAGGAGGTCGGGGACATGCTGAATGGCAAAGAAAGGATAGAAGCTGCTCTTAAGAAGGCAAAAGAAGCGAATGAATTGTACAGAGCTAAGAAATATGCAAGGGCTTCTAAACAATTATAG | 267 | 0.4232 | MTMKRGEVALLTIPPEYAFGSSESQRELAVVPPNSTLYYEVELVTFIKDKEVGDMLNGKERIEAALKKAKEANELYRAKKYARASKQL* | 89 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Psa4g4717 | 88 | Coils | Coil | 59 | 79 | - | - | |
| Psa4g4717 | 88 | Gene3D | - | 1 | 78 | IPR046357 | GO:0003755 | |
| Psa4g4717 | 88 | ProSiteProfiles | FKBP-type peptidyl-prolyl cis-trans isomerase domain profile. | 1 | 47 | IPR001179 | GO:0003755 | |
| Psa4g4717 | 88 | Pfam | FKBP-type peptidyl-prolyl cis-trans isomerase | 2 | 44 | IPR001179 | GO:0003755 | |
| Psa4g4717 | 88 | PANTHER | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE | 1 | 66 | - | - | |
| Psa4g4717 | 88 | PANTHER | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP65 | 1 | 66 | - | - | |
| Psa4g4717 | 88 | SUPERFAMILY | FKBP-like | 2 | 52 | - | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Psa4g4717 | Psa-Chr4 | 416533318 | 416533673 | Proximal |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Psa4g4717 | 1 | 87 | Calmodulin-binding Proteins | AT5G48570 | 72.414 | 8.70e-36 | 125 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Psa4g4717 | K09571 | K01802 | ath:AT5G48570 | 118.627 |