Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Psa4g3076 | ATGACCACCGAAGAACCCATCATCTCCGTTGAACCCGTGTCCGAACCAGGAACCGCCGAACCTCCGGACTTGGAGGAAGTTGATGAACCAAAGGCCGAAACTGAGAAGATGAAGAAAGTCAAGGAAACCGAACCTAAGAAAGATTCCAAACCACGAAACCTTGCTTCCCATCCTACTTACGAAGAGATGATTAAGGATGCAATAGTGTCGTTAAAGGAGAAGAACGGTTCGAGCCAATACGCGATTGTGAAATTCATTAAAGAGAAACAGAAACAGCTTCCTGGAAACTTCAAGAAGCTATTTCTCCAAAATTTGAAGAAGAATGTTGCTTTTGGAAAGCTTGCTAAGGTTAAAGGTTCGTTCAAGCTTTCTGCAGCAGCTAAGAAGCCAGCAGTTGCCAAGCCAAAGTCAAAACCAG | 418 | 0.4426 | MTTEEPIISVEPVSEPGTAEPPDLEEVDEPKAETEKMKKVKETEPKKDSKPRNLASHPTYEEMIKDAIVSLKEKNGSSQYAIVKFIKEKQKQLPGNFKKLFLQNLKKNVAFGKLAKVKGSFKLSAAAKKPAVAKPKSKP | 139 |
Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Psa4g3076 | 139 | SUPERFAMILY | "Winged helix" DNA-binding domain | 55 | 133 | IPR036390 | - | |
Psa4g3076 | 139 | PANTHER | LINKER HISTONE H1 AND H5 FAMILY PROTEIN | 3 | 139 | - | - | |
Psa4g3076 | 139 | CDD | H15 | 55 | 124 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Psa4g3076 | 139 | PRINTS | Histone H5 signature | 43 | 64 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Psa4g3076 | 139 | PRINTS | Histone H5 signature | 70 | 87 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Psa4g3076 | 139 | SMART | h15plus2 | 54 | 120 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Psa4g3076 | 139 | MobiDBLite | consensus disorder prediction | 29 | 55 | - | - | |
Psa4g3076 | 139 | Gene3D | - | 52 | 138 | IPR036388 | - | |
Psa4g3076 | 139 | MobiDBLite | consensus disorder prediction | 1 | 59 | - | - | |
Psa4g3076 | 139 | Pfam | linker histone H1 and H5 family | 57 | 124 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Psa4g3076 | 139 | PANTHER | HISTONE H1 | 3 | 139 | - | - | |
Psa4g3076 | 139 | ProSiteProfiles | Linker histone H1/H5 globular (H15) domain profile. | 56 | 125 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 |
Select | Gene | Chromosome | Start | End | Duplicated_type |
---|---|---|---|---|---|
Psa4g3076 | Psa-Chr4 | 252177767 | 252178184 | Tandem |
Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
---|---|---|---|---|---|---|---|---|
Psa4g3076 | 58 | 136 | Single Myb Histone (SMH) Gene Family | AT1G17520 | 36.585 | 8.92e-08 | 47.8 |
Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Psa4g3076 | K11275 | - | gmx:100775944 | 141.354 |