Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Prci2g2298 ATGGGGAAGCAACCGGTTAGGATGAAGGCCGTGGTCTATGCTCTTTCACCTTTCCAGCAGAAGGTTATGACTGGTCTCTGGAAGGATTTGCCTTCCAAAATTCACCACAAGGTCTCTGAGAATTGGATCAGCGCCACGCTTTTGCTCGCTCCTCTTATCGGCACCTACACGTATGTTCAGAACTACCAGGAAAAGGAGAAGTTGGCTCACAGGTACTGA 219 0.4932 MGKQPVRMKAVVYALSPFQQKVMTGLWKDLPSKIHHKVSENWISATLLLAPLIGTYTYVQNYQEKEKLAHRY 72
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Prci2g2298 72 Gene3D - 2 72 IPR036642 GO:0005750|GO:0006122
Prci2g2298 72 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 10 65 IPR036642 GO:0005750|GO:0006122
Prci2g2298 72 Pfam Cytochrome b-c1 complex subunit 8 1 72 IPR020101 GO:0005750|GO:0070469
Prci2g2298 72 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 1 72 IPR020101 GO:0005750|GO:0070469
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Prci2g2298 Prci-Chr2 18071020 18073334 Dispersed/Wgd
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Prci2g2298 1 72 Chloroplast and Mitochondria Gene Families AT5G05370 76.389 1.49e-40 125
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Prci2g2298 - - mnt:21401780 146.747
       

Event-related genes

Select Gene_1 Chr_1 Start_1 End_1 Gene_2 Chr_2 Start_2 End_2 Event_name
Prci2g2298 2 18071020 18073334 Prci2g2298 2 18071020 18073334 ECH