Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Pral597g00003 ATGGGGAAGCAACCCGTTAGGATGAAGGCCGTGGTCTATGCTCTTTCACCTTTCCAGCAGAAAGTTATGACTGGTCTCTGGAAGGATTTGCCTTCCAAGATTCACCACAAGATCTCTGAGAATTGGATCAGCGCCACGCTCTTGCTCGGTCCTCTTGTCGGCACCTATACGTATGTTCAAAACTACCAGGAAAAGGAGAAGCTGGCTCACAGGTACTGA 219 0.4932 MGKQPVRMKAVVYALSPFQQKVMTGLWKDLPSKIHHKISENWISATLLLGPLVGTYTYVQNYQEKEKLAHRY 72
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Pral597g00003 72 Pfam Cytochrome b-c1 complex subunit 8 1 72 IPR020101 GO:0005750|GO:0070469
Pral597g00003 72 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 1 72 IPR020101 GO:0005750|GO:0070469
Pral597g00003 72 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 10 65 IPR036642 GO:0005750|GO:0006122
Pral597g00003 72 Gene3D - 2 72 IPR036642 GO:0005750|GO:0006122
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Pral597g00003 Pral-Chr597 17911 19824 Dispersed
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Pral597g00003 1 72 Chloroplast and Mitochondria Gene Families AT3G10860 77.778 2.85e-40 125
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Pral597g00003 - - mnt:21401780 145.976