Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Pral4981g00025 ATGGGAAAGCAACCGGTGAAGTTGAAGGCCGTGATCTATACCCTATCGCCTTTCCAACAGAAGGTGATGACTGGGCTTTGGAAGGATTTACCTACCAAAATTCACCACAAGATCTCCGAGAATTGGATCAGCGCCACTCTCTTGCTAGGTCCTCTCGTTGGCACCTACTCGTATGTTCAGCACTACCAGGAGAAAGAGAAGTTGGCTCACAGGTATTGA 219 0.484 MGKQPVKLKAVIYTLSPFQQKVMTGLWKDLPTKIHHKISENWISATLLLGPLVGTYSYVQHYQEKEKLAHRY 72
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Pral4981g00025 72 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 1 72 IPR020101 GO:0005750|GO:0070469
Pral4981g00025 72 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 10 64 IPR036642 GO:0005750|GO:0006122
Pral4981g00025 72 Gene3D - 2 72 IPR036642 GO:0005750|GO:0006122
Pral4981g00025 72 Pfam Cytochrome b-c1 complex subunit 8 1 72 IPR020101 GO:0005750|GO:0070469
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Pral4981g00025 Pral-Chr4981 115316 116989 Dispersed
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Pral4981g00025 1 72 Chloroplast and Mitochondria Gene Families AT5G05370 76.389 2.58e-40 125
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Pral4981g00025 - - qsa:O6P43_020475 140.198