Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Mepo6g00219 ATGGGAGTTGAGAAGCAAATCGTTCGACCTGGAAACGGTCCTAAGCCAACTCCTGGTCAAAACGTCACTGTCCACTGCACCGGATACGGGAAAAACCGTGACCTGTCTCAGAAATTCTGGAGTACAAAAGATCCTGGTCAGAGTCCATTCACTTTCAAAATCGGCAAAGGTTCTGTCATCAAAGGATGGGATGAAGGTGTCATTGGCATGCAAATCGGAGAAGTTGCTCGTCTTCGGTGCTCTCCGGATTATGCTTATGGTGCTAGTGGTTTTCCTGCTTGGGGAATACAACCCAACTCTGTCTTGGAGTTTGAGATCGAGGTCTTGAGTGCAGAATGA 339 0.4779 MGVEKQIVRPGNGPKPTPGQNVTVHCTGYGKNRDLSQKFWSTKDPGQSPFTFKIGKGSVIKGWDEGVIGMQIGEVARLRCSPDYAYGASGFPAWGIQPNSVLEFEIEVLSAE 112
       

Annotation information


Select Seq ID Length Analysis Description Start End IPR GO
Mepo6g00219 112 FunFam Peptidylprolyl isomerase 1 112 - -
Mepo6g00219 112 MobiDBLite consensus disorder prediction 1 22 - -
Mepo6g00219 112 PANTHER PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 2 111 - -
Mepo6g00219 112 Pfam FKBP-type peptidyl-prolyl cis-trans isomerase 14 109 IPR001179 GO:0003755
Mepo6g00219 112 ProSiteProfiles FKBP-type peptidyl-prolyl cis-trans isomerase domain profile. 19 112 IPR001179 GO:0003755
Mepo6g00219 112 Gene3D - 1 112 IPR046357 GO:0003755
Mepo6g00219 112 SUPERFAMILY FKBP-like 2 110 - -
       

Duplication type information


Select Gene Chromosome Start End Duplicated_type
Mepo6g00219 Mepo-Chr6 2134176 2136578 Dispersed/Transposed
       

Functional genes information


Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Mepo6g00219 2 110 Calmodulin-binding Proteins AT5G48570 39.091 7.51e-16 70.1
       

Pathway information


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mepo6g00219 K01802 - pop:7486076 219.935