| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Mepo3g06013 | ATGAATTACAGATGTTGTGTTTGTTTGGGAGAATTTGAGGTGAAGGAAGAGTTGCTACAGATTCCATATTGCAAGCATGTGTTCCACATCGATTGCATACATCACTGGCTACAATCAAATTCAACTTGTCCACTTTGTAGATGTTCCATCATTCCCACTATCACTAAATTCCTTAATCCTGCACCCCCTATTAATATTATTATATCAGACCCACCTCACCAAGATGCTATCAATTTGGATTCTCCATTACAAAATTCATCATTGCAAGATGAAGCTGGGGCTTCCTCAAATATCATGTCAAGAGAATGA | 309 | 0.3786 | MNYRCCVCLGEFEVKEELLQIPYCKHVFHIDCIHHWLQSNSTCPLCRCSIIPTITKFLNPAPPINIIISDPPHQDAINLDSPLQNSSLQDEAGASSNIMSRE | 102 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Mepo3g06013 | 102 | MobiDBLite | consensus disorder prediction | 78 | 102 | - | - | |
| Mepo3g06013 | 102 | Pfam | Ring finger domain | 4 | 47 | IPR001841 | - | |
| Mepo3g06013 | 102 | ProSiteProfiles | Zinc finger RING-type profile. | 5 | 47 | IPR001841 | - | |
| Mepo3g06013 | 102 | Gene3D | Zinc/RING finger domain, C3HC4 (zinc finger) | 1 | 54 | IPR013083 | - | |
| Mepo3g06013 | 102 | SMART | ring_2 | 5 | 46 | IPR001841 | - | |
| Mepo3g06013 | 102 | PANTHER | RING-H2 FINGER PROTEIN ATL16 | 3 | 84 | IPR044600 | GO:0016567|GO:0016740 | |
| Mepo3g06013 | 102 | MobiDBLite | consensus disorder prediction | 75 | 102 | - | - | |
| Mepo3g06013 | 102 | SUPERFAMILY | RING/U-box | 4 | 53 | - | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Mepo3g06013 | Mepo-Chr3 | 74366055 | 74366879 | Transposed |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Mepo3g06013 | 1 | 78 | C3H Transcription Factor Family | AT1G33480 | 39.759 | 6.95e-18 | 73.9 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Mepo3g06013 | K19039 | - | gmx:100794298 | 156.377 |