Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Mal1g1330 | ATGTCTTCCACCACCGCCACTCAGCCCAAGCCCAAGAAAACCGTTGCAGCAAAGAAGACTCTCTCTCATCCAACCTACGCAGAGATGATAACTGAAGCAATTGTGAGTCTGAAAGAAAGAACCGGATCAAGCCAACACGCGATAACCAAATTCATCGAAGAGAAACACAAGGATTTATCTCCAACTTACCGTAAACTCGTTCTGCTTCAATTGAAGAAATCTGTGGCTTCTGGAAAGCTCGTGAAGGTGAAAAACTCTTTCAAACTCGCACCACCGCCGGCGAAAACTGCTCCGGTGAAAGCCGCCGCTGCTCCTGCTAAGAAGGCTAAGGCTGTCACCAAGCCGGCTGCCAAGGCTGCGACTAAGCCGAAGGCAAAGGCTGCTGTGAAGCCGAAAGCTGCCGCGAAGCCAAAAGCAGCGGCGAAGCCGAAAGCTGTTGTGAAGCCGAAAGCGAAGAGTGTTAAGGCTACGCCGGTGAAGAAGGCGGTGAAAAAAGTGGTTGCGAAGGGAGTGAAGAAGCCAAAGAGTGTGAAGACTCCGGTTAAGAAGGCTAAGAAGTGA | 561 | 0.508 | MSSTTATQPKPKKTVAAKKTLSHPTYAEMITEAIVSLKERTGSSQHAITKFIEEKHKDLSPTYRKLVLLQLKKSVASGKLVKVKNSFKLAPPPAKTAPVKAAAAPAKKAKAVTKPAAKAATKPKAKAAVKPKAAAKPKAAAKPKAVVKPKAKSVKATPVKKAVKKVVAKGVKKPKSVKTPVKKAKK* | 187 |
Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Mal1g1330 | 186 | CDD | H15 | 22 | 93 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Mal1g1330 | 186 | PANTHER | HISTONE H1 | 4 | 185 | - | - | |
Mal1g1330 | 186 | Pfam | linker histone H1 and H5 family | 23 | 90 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Mal1g1330 | 186 | SUPERFAMILY | "Winged helix" DNA-binding domain | 19 | 100 | IPR036390 | - | |
Mal1g1330 | 186 | PANTHER | LINKER HISTONE H1 AND H5 FAMILY PROTEIN | 4 | 185 | - | - | |
Mal1g1330 | 186 | PRINTS | Histone H5 signature | 36 | 53 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Mal1g1330 | 186 | PRINTS | Histone H5 signature | 172 | 186 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Mal1g1330 | 186 | PRINTS | Histone H5 signature | 9 | 30 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Mal1g1330 | 186 | PRINTS | Histone H5 signature | 118 | 132 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Mal1g1330 | 186 | MobiDBLite | consensus disorder prediction | 89 | 186 | - | - | |
Mal1g1330 | 186 | Gene3D | - | 17 | 97 | IPR036388 | - | |
Mal1g1330 | 186 | ProSiteProfiles | Linker histone H1/H5 globular (H15) domain profile. | 22 | 91 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Mal1g1330 | 186 | MobiDBLite | consensus disorder prediction | 165 | 186 | - | - | |
Mal1g1330 | 186 | MobiDBLite | consensus disorder prediction | 143 | 159 | - | - | |
Mal1g1330 | 186 | SMART | h15plus2 | 20 | 86 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 |
Select | Gene | Chromosome | Start | End | Duplicated_type |
---|---|---|---|---|---|
Mal1g1330 | Mal-Chr1 | 17137975 | 17138621 | Wgd |
Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
---|---|---|---|---|---|---|---|---|
Mal1g1330 | 11 | 96 | Single Myb Histone (SMH) Gene Family | AT1G72740 | 31.395 | 1.26e-08 | 51.6 |
Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Mal1g1330 | K11275 | - | gmx:100810590 | 123.25 |