| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Gma19g01733 | ATGCTTCGGTCTTGTCTCAAGCAGTTGCAAAAGAATCTATCGAGTTTTGTTCactccaatgaagatcaagtactggaagcagtaactttggtgccagaagatgttatggagggtcattttgctgttcttgccatcaagggtgaagatacaagaaggtttattgttaagttagactacttgactgatcctatgttcatggaactactgaaccaagctcgagaggagtatggtttcaaacaaaagggagcacttgcagtcccttgcaggcctcaggaattacagaacattctagatggcccaagagcCAAAGCTGAAAG | 317 | 0.082 | MLRSCLKQLQKNLSSFVHSNEDQVLEAVTLVPEDVMEGHFAVLAIKGEDTRRFIVKLDYLTDPMFMELLNQAREEYGFKQKGALAVPCRPQELQNILDGPRAKAE | 105 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Gma19g01733 | 105 | PANTHER | AUXIN-INDUCED PROTEIN-LIKE-RELATED | 1 | 103 | IPR003676 | GO:0009733 | |
| Gma19g01733 | 105 | Pfam | Auxin responsive protein | 27 | 97 | IPR003676 | GO:0009733 | |
| Gma19g01733 | 105 | PANTHER | F8A24.8 PROTEIN | 1 | 103 | - | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Gma19g01733 | Gma-Chr19 | 46628755 | 46629071 | Dispersed/Wgd |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Gma19g01733 | 2 | 97 | Calmodulin-binding Proteins | AT4G34750 | 39.583 | 4.39e-15 | 64.7 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Gma19g01733 | - | K14488 | gmx:100794061 | 211.075 |