Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Enph13g0174 ATGGGGAAGCAACCGGCGAGGATGAAGGCCGTCATCTACGCCCTCTCACCTTTCCAGCAGAAGGTGATGACTGGACTCTGGAAGGATCCACCGGCAAAGATTCACCACAAAGTCTCTGAGAATTGGCTCAACGCCTTTCTCTTCCTCACCCCTCTCCTCCGCACCTACTACTATGTCAAACAATACAAGGAGAAGGAGAAGTTGACCCACCTTTATTGA 219 0.5114 MGKQPARMKAVIYALSPFQQKVMTGLWKDPPAKIHHKVSENWLNAFLFLTPLLRTYYYVKQYKEKEKLTHLY 72
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Enph13g0174 72 Pfam Cytochrome b-c1 complex subunit 8 1 72 IPR020101 GO:0005750|GO:0070469
Enph13g0174 72 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9 65 IPR036642 GO:0005750|GO:0006122
Enph13g0174 72 Gene3D - 2 72 IPR036642 GO:0005750|GO:0006122
Enph13g0174 72 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 1 71 IPR020101 GO:0005750|GO:0070469
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Enph13g0174 Enph-Chr13 7522190 7523589 Transposed
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Enph13g0174 1 72 Chloroplast and Mitochondria Gene Families AT3G10860 66.667 3.39e-34 109
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Enph13g0174 - - nnu:104612972 119.398