Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Dere05g1181 ATGGTTAATTTTGAACTCTGCCGATTCTTCGCTGCCATTTCTAATTCTACACAATCGGATTCGATCGGAGGAAGACGACGATCACAGGTGGGAACAACTGAGATGGGGAAGCAACCGGTGAGGATGAAGGCCGTGGTCTATGCCCTTTCACCTTTCCAGCAGAAGGTAATGACTGGGCTTTGGAAGGATTTGCCTTCCAAGATTCACCACAAGATCTCTGAGAATTGGATCAGCGCTACTCTCCTCCTCGGTCCTCTCGTCGGCACCTATACGTATGTTCAGAACTACCAGGAAAAGGAGAAGTTGGCTCACAGGTACTGA 321 0.4891 MVNFELCRFFAAISNSTQSDSIGGRRRSQVGTTEMGKQPVRMKAVVYALSPFQQKVMTGLWKDLPSKIHHKISENWISATLLLGPLVGTYTYVQNYQEKEKLAHRY 106
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Dere05g1181 106 Gene3D - 34 106 IPR036642 GO:0005750|GO:0006122
Dere05g1181 106 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 43 98 IPR036642 GO:0005750|GO:0006122
Dere05g1181 106 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 35 106 IPR020101 GO:0005750|GO:0070469
Dere05g1181 106 Pfam Cytochrome b-c1 complex subunit 8 35 106 IPR020101 GO:0005750|GO:0070469
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Dere05g1181 Dere-ChrDere05 18997145 19000135 Dispersed
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Dere05g1181 35 106 Chloroplast and Mitochondria Gene Families AT3G10860 77.778 1.45e-40 127
       

Event-related genes

Select Gene_1 Chr_1 Start_1 End_1 Gene_2 Chr_2 Start_2 End_2 Event_name
Dere05g1181 05 18997145 19000135 Dere05g1181 05 18997145 19000135 ECH