| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Cca05g02024 | ATGGGTGACTCGGATAACGACTCGGGCGGGGCGGCGAACAGGAGTGAGTTGTCGCCTCGGGAGCAGGACCGCTTCATAACGGGCGAGGCCTCCGACAAGTGCCAGCGGGAGAAGCGGAAGACCATCAACGGCGACGACCTCCTCTGGGCCATGACAACGCTCGGCTTCGAGGACTACGTCGACCCTCTCAAGGTTTACCTCCAGCGCTTCCGGGAGATCGAGGGCGAGAAGACCGTCGCCGCTCGCGACAAGGACGCTGCCTCCGCCGCCGCTACTTACGActacccctccccctccccctctccctcccccgccGTCATGcaccatcaccatcaccatcaccatcacGGACACGGACACGTGTACGGCTCCCCCGCCTTCCACGCTCCTGTTATgcctatgcctaagcctgggcctttgcctgggcctgggcctggccctggcccCACTTATCCTCCTGGTAGACCCAGATAG | 474 | 0.481 | MGDSDNDSGGAANRSELSPREQDRFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKVYLQRFREIEGEKTVAARDKDAASAAATYDYPSPSPSPSPAVMHHHHHHHHHGHGHVYGSPAFHAPVMPMPKPGPLPGPGPGPGPTYPPGRPR | 157 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Cca05g02024 | 157 | MobiDBLite | consensus disorder prediction | 130 | 157 | - | - | |
| Cca05g02024 | 157 | MobiDBLite | consensus disorder prediction | 106 | 121 | - | - | |
| Cca05g02024 | 157 | Pfam | Histone-like transcription factor (CBF/NF-Y) and archaeal histone | 24 | 51 | IPR003958 | - | |
| Cca05g02024 | 157 | SUPERFAMILY | Histone-fold | 25 | 105 | IPR009072 | GO:0046982 | |
| Cca05g02024 | 157 | MobiDBLite | consensus disorder prediction | 80 | 157 | - | - | |
| Cca05g02024 | 157 | PANTHER | CCAAT-BINDING TRANSCRIPTION FACTOR-RELATED | 25 | 117 | IPR027113 | GO:0001228|GO:0006355|GO:0016602 | |
| Cca05g02024 | 157 | MobiDBLite | consensus disorder prediction | 1 | 44 | - | - | |
| Cca05g02024 | 157 | MobiDBLite | consensus disorder prediction | 17 | 44 | - | - | |
| Cca05g02024 | 157 | PRINTS | CCAAT-binding transcription factor subunit A signature | 15 | 33 | - | - | |
| Cca05g02024 | 157 | PRINTS | CCAAT-binding transcription factor subunit A signature | 53 | 71 | - | - | |
| Cca05g02024 | 157 | PRINTS | CCAAT-binding transcription factor subunit A signature | 34 | 52 | - | - | |
| Cca05g02024 | 157 | Gene3D | Histone, subunit A | 23 | 96 | IPR009072 | GO:0046982 | |
| Cca05g02024 | 157 | PANTHER | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-2 | 25 | 117 | - | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Cca05g02024 | Cca-Chr5 | 40063515 | 40065520 | Wgd |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Cca05g02024 | 1 | 81 | CCAAT-HAP3 Transcription Factor Family | AT4G14540 | 55.462 | 4.06e-38 | 126 |
| Select | Regulatory Factors | Family | Gene | Hmm_acc | Hmm_name | E_value | Clan |
|---|---|---|---|---|---|---|---|
| TF | NF-YB | Cca05g02024 | CBFD_NFYB_HMF | 1.9e-06 | CL0012 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Cca05g02024 | K08065 | - | gmx:100813169 | 147.132 |