Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Car04g00463 | ATGTCGACCACAGCGGCTCAACCCAAGTCAAAGAAAACAGCTTCGACAAAGAAGCCACTTTCTCATCCAACCTACGCTGAGATGATAACTGAGGCTATTGTGAGTCTGAAAGAAAGAACTGGTTCAAGCCAACACGCGATAACCAAATTCATCGAAGAAAAGCACAAGGATCTATCTCCCACCTTCCGCAAATTAATCTTGCTTCATCTCAAAAAGTCGGTGGCTGCAGGCAAGCTTGTTAAGGTTAAGGGTTCATTCAAACTCGCTCCGGCTAAATCTTCTGTGGCTAAACCTAAAGCCGCTACTGCTCCCGCTGCTACCAAGAAGGCTAAGGCTGTTACCAAGCCAGCCGCCAAGGCTGCTACCAAGCCCAAGGCTAAAGCTGTTGCGAAGCCTAAAGCAGCGGCAAAGCCCAAAGCTGCAACGAAGCCGAAAACGGCGGCGAAGCCAAAAGCGAAGACGGTTAAGACAACACCGGTGAAGAAGGCTGTTGCTAAGACAACGAAGAAGGTTCCTGTGAAGGGTGTGAAGAAGCCTAAGAGCGTTAAAACGCCGGTGAAGAAGGCTAAGAAATGA | 576 | 0.4896 | MSTTAAQPKSKKTASTKKPLSHPTYAEMITEAIVSLKERTGSSQHAITKFIEEKHKDLSPTFRKLILLHLKKSVAAGKLVKVKGSFKLAPAKSSVAKPKAATAPAATKKAKAVTKPAAKAATKPKAKAVAKPKAAAKPKAATKPKTAAKPKAKTVKTTPVKKAVAKTTKKVPVKGVKKPKSVKTPVKKAKK | 191 |
Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Car04g00463 | 191 | CDD | H15 | 21 | 95 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Car04g00463 | 191 | MobiDBLite | consensus disorder prediction | 1 | 20 | - | - | |
Car04g00463 | 191 | ProSiteProfiles | Linker histone H1/H5 globular (H15) domain profile. | 21 | 90 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Car04g00463 | 191 | Gene3D | - | 16 | 103 | IPR036388 | - | |
Car04g00463 | 191 | SUPERFAMILY | "Winged helix" DNA-binding domain | 18 | 98 | IPR036390 | - | |
Car04g00463 | 191 | PANTHER | HISTONE H1 | 3 | 190 | - | - | |
Car04g00463 | 191 | MobiDBLite | consensus disorder prediction | 1 | 23 | - | - | |
Car04g00463 | 191 | SMART | h15plus2 | 19 | 85 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
Car04g00463 | 191 | MobiDBLite | consensus disorder prediction | 97 | 191 | - | - | |
Car04g00463 | 191 | MobiDBLite | consensus disorder prediction | 167 | 191 | - | - | |
Car04g00463 | 191 | PRINTS | Histone H5 signature | 8 | 29 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Car04g00463 | 191 | PRINTS | Histone H5 signature | 35 | 52 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Car04g00463 | 191 | PRINTS | Histone H5 signature | 113 | 127 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Car04g00463 | 191 | PRINTS | Histone H5 signature | 177 | 191 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
Car04g00463 | 191 | PANTHER | LINKER HISTONE H1 AND H5 FAMILY PROTEIN | 3 | 190 | - | - | |
Car04g00463 | 191 | Pfam | linker histone H1 and H5 family | 22 | 89 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 |
Select | Gene | Chromosome | Start | End | Duplicated_type |
---|---|---|---|---|---|
Car04g00463 | Car-Chr4 | 4792104 | 4793126 | Dispersed/Wgd |
Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
---|---|---|---|---|---|---|---|---|
Car04g00463 | 23 | 99 | Single Myb Histone (SMH) Gene Family | AT1G72740 | 32.051 | 2.87e-07 | 47.8 |
Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Car04g00463 | K11275 | - | gmx:100810590 | 129.028 |