| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Bach7g00383 | ATGGAGGATTCAGAAGGAGTCCTCAGCTTCGACTTCGAGGGTGGCCTTGACCCCGCTCCGCACAACCCTCCGGGACCGCCGCCCCAATCTGACTCGTTTGCTACTGCTGCTGCTTCTGCCGCGACTAACAGAACATCCACTGCTCCCTCCACCGGTCATGCCGCCGGCAATATCCCTGGGCGACGGAGCTTCCGTCAGACAGTGTGCCGTCACTGGCTTCGTGGGCTATGCATGAAAGGCGATGCTTGTGGGTTCTTGCACCAGTATGACAAGTCTCGGATGCCTATCTGCCGATTTTTCAGATTGTATGGGGAGTGTCGCGAGCAAGATTGCGTGTATAAGCATACAAATGAAGATATCAAGGAGTGTAACATGTATGTATTCAATCTTCATTTCGAATTTCATTGA | 408 | 0.527 | MEDSEGVLSFDFEGGLDPAPHNPPGPPPQSDSFATAAASAATNRTSTAPSTGHAAGNIPGRRSFRQTVCRHWLRGLCMKGDACGFLHQYDKSRMPICRFFRLYGECREQDCVYKHTNEDIKECNMYVFNLHFEFH | 135 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Bach7g00383 | 135 | FunFam | Cleavage and polyadenylation specificity factor 30 kDa subunit | 59 | 119 | - | - | |
| Bach7g00383 | 135 | PANTHER | CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR SUBUNIT 4-RELATED | 10 | 126 | IPR045348 | GO:0003723|GO:0098789 | |
| Bach7g00383 | 135 | Gene3D | - | 57 | 122 | - | - | |
| Bach7g00383 | 135 | MobiDBLite | consensus disorder prediction | 32 | 53 | - | - | |
| Bach7g00383 | 135 | MobiDBLite | consensus disorder prediction | 1 | 60 | - | - | |
| Bach7g00383 | 135 | ProSiteProfiles | Zinc finger C3H1-type profile. | 91 | 118 | IPR000571 | GO:0046872 | |
| Bach7g00383 | 135 | ProSiteProfiles | Zinc finger C3H1-type profile. | 63 | 90 | IPR000571 | GO:0046872 | |
| Bach7g00383 | 135 | SUPERFAMILY | CCCH zinc finger | 64 | 88 | IPR036855 | GO:0046872 | |
| Bach7g00383 | 135 | SMART | c3hfinal6 | 63 | 89 | IPR000571 | GO:0046872 | |
| Bach7g00383 | 135 | SMART | c3hfinal6 | 91 | 117 | IPR000571 | GO:0046872 |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Bach7g00383 | Bach-Chr7 | 13348761 | 13349168 | Dispersed/Tandem |
| Select | Regulatory Factors | Family | Gene | Hmm_acc | Hmm_name | E_value | Clan |
|---|---|---|---|---|---|---|---|
| TF | C3H | Bach7g00383 | None | None | None |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Bach7g00383 | K14404 | - | gmx:100802826 | 193.356 |
| Select | Gene_1 | Chr_1 | Start_1 | End_1 | Gene_2 | Chr_2 | Start_2 | End_2 | Event_name |
|---|---|---|---|---|---|---|---|---|---|
| Bach7g00383 | 7 | 13348761 | 13349168 | Bach7g00383 | 7 | 13348761 | 13349168 | ECH |