| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Apr8g1532 | ATGTCCACCACAGCGCAAGCCAAAGCCAAGAGAAAAATGGCGGCGACTAAGAAGCCACTCTCTCATCCTCCCTTTGCCGTGATGATAACAGAGGCTATTGCAAGTCTAAAGGAGAGAACTGGTTCGAGCCAGTATGCGATAACAAAGTTTATTGAAGGGAAGCACAAGGAGTTGCCTCCAACATTTCGTAAGCTGATTCTCCACCAGCTCAAGAAGGCTGTAGCCTCAGGCAAGCTAGTTAAAGTAAAAAACTCATTCAAGCTCGCGCCGACTCGATCGGCTCCGGTTAAAGCTGCTCCTGCTCCTGCTGCTAAGAAGCCTAAAGCTGTGACTAAGCCCAGTACCAAGGCTGCTGCGTCCAAGCCCAAAGCTGCAGCTAAAACTAAGGCTGTTGCCAAGCCCAAGGCGAAGACCACGGCGTCAAGTGCTAAGCCAAAGGCGAAGGCGGCTAAGGTGACGGTTGCGAAGAAGGTTGCTGCTAAGCCAGCGAGGAAGACGCCAGTAAAGAGTGCAAAGAAGCCAAAGAGTGTTAAATCGCCGGCGAAGAAGGCTAAGAAGTGA | 561 | 0.5116 | MSTTAQAKAKRKMAATKKPLSHPPFAVMITEAIASLKERTGSSQYAITKFIEGKHKELPPTFRKLILHQLKKAVASGKLVKVKNSFKLAPTRSAPVKAAPAPAAKKPKAVTKPSTKAAASKPKAAAKTKAVAKPKAKTTASSAKPKAKAAKVTVAKKVAAKPARKTPVKSAKKPKSVKSPAKKAKK* | 187 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Apr8g1532 | 186 | SMART | h15plus2 | 19 | 85 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Apr8g1532 | 186 | PRINTS | Histone H5 signature | 8 | 29 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Apr8g1532 | 186 | PRINTS | Histone H5 signature | 35 | 52 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Apr8g1532 | 186 | PRINTS | Histone H5 signature | 111 | 125 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Apr8g1532 | 186 | PRINTS | Histone H5 signature | 144 | 161 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Apr8g1532 | 186 | PRINTS | Histone H5 signature | 166 | 185 | IPR005819 | GO:0000786|GO:0003677|GO:0006334|GO:0030527 | |
| Apr8g1532 | 186 | CDD | H15 | 21 | 93 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Apr8g1532 | 186 | Pfam | linker histone H1 and H5 family | 22 | 89 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Apr8g1532 | 186 | MobiDBLite | consensus disorder prediction | 92 | 186 | - | - | |
| Apr8g1532 | 186 | Gene3D | - | 17 | 94 | IPR036388 | - | |
| Apr8g1532 | 186 | PANTHER | HISTONE H1 | 2 | 185 | - | - | |
| Apr8g1532 | 186 | SUPERFAMILY | "Winged helix" DNA-binding domain | 18 | 100 | IPR036390 | - | |
| Apr8g1532 | 186 | MobiDBLite | consensus disorder prediction | 162 | 186 | - | - | |
| Apr8g1532 | 186 | ProSiteProfiles | Linker histone H1/H5 globular (H15) domain profile. | 21 | 90 | IPR005818 | GO:0000786|GO:0003677|GO:0006334 | |
| Apr8g1532 | 186 | PANTHER | LINKER HISTONE H1 AND H5 FAMILY PROTEIN | 2 | 185 | - | - |
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Apr8g1532 | Apr-Chr8 | 24758163 | 24759045 | Dispersed/Wgd |
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Apr8g1532 | 23 | 88 | Single Myb Histone (SMH) Gene Family | AT1G72740 | 36.364 | 3.81e-09 | 52.8 |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Apr8g1532 | K11275 | - | gmx:100810590 | 140.969 |