Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Alju07g1133 ATGGGGAAGCAACCGGTTAGGATGAAGGCCGTGGTCTATGCTCTTTCACCTTTCCAGCAGAAGGTTATGACTGGTCTCTGGAAGGATTTTCCTTCCAAGATCCACCACAAGATCTCTGAGAATTGGCTCAGCGCCACGCTCTTGCTTGGTCCTCTTATCGGCGTCCATACGTATGTTAAAAACTACCAGGAAAAGGAGAAGCTGGCTCACAGGTACTGA 219 0.4932 MGKQPVRMKAVVYALSPFQQKVMTGLWKDFPSKIHHKISENWLSATLLLGPLIGVHTYVKNYQEKEKLAHRY 72
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Alju07g1133 72 Pfam Cytochrome b-c1 complex subunit 8 1 72 IPR020101 GO:0005750|GO:0070469
Alju07g1133 72 Gene3D - 2 72 IPR036642 GO:0005750|GO:0006122
Alju07g1133 72 SUPERFAMILY Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 10 65 IPR036642 GO:0005750|GO:0006122
Alju07g1133 72 PANTHER CYTOCHROME B-C1 COMPLEX SUBUNIT 8 1 72 IPR020101 GO:0005750|GO:0070469
       

Duplication type information

Select Gene Chromosome Start End Duplicated_type
Alju07g1133 Alju-ChrAlju07 34670449 34672219 Dispersed/Wgd
       

Functional genes information

Select Gene Gene_start Gene_end Function Ath_gene Identity(%) E-value Score
Alju07g1133 1 72 Chloroplast and Mitochondria Gene Families AT3G10860 69.444 7.48e-37 116
       

Event-related genes

Select Gene_1 Chr_1 Start_1 End_1 Gene_2 Chr_2 Start_2 End_2 Event_name
Alju07g1133 07 34670449 34672219 Alju07g1133 07 34670449 34672219 ECH