Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Accr4g01302 | ATGGGGAAGCAACCGGTGAGGTTGAAGGCCGTAATCTATACCCTATCGCCTTTCCAGCAGAAGGTCATGACCGGGCTTTGGAAGGATTTACCTACCAAGATTCACCACAAGATCTCCGAGAATTGGATCAGCGCCACTCTCTTGCTTGGTCCCCTCGTCGGCACCTACTCGTATGTTCAGAACTACCTGGAGAAAGAGAAGTTGGCTCACAGGTACTGA | 219 | 0.5114 | MGKQPVRLKAVIYTLSPFQQKVMTGLWKDLPTKIHHKISENWISATLLLGPLVGTYSYVQNYLEKEKLAHRY | 72 |
Annotation information
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Accr4g01302 | 72 | Gene3D | - | 2 | 72 | IPR036642 | GO:0005750|GO:0006122 | |
| Accr4g01302 | 72 | Pfam | Cytochrome b-c1 complex subunit 8 | 1 | 72 | IPR020101 | GO:0005750|GO:0070469 | |
| Accr4g01302 | 72 | PANTHER | CYTOCHROME B-C1 COMPLEX SUBUNIT 8 | 1 | 72 | IPR020101 | GO:0005750|GO:0070469 | |
| Accr4g01302 | 72 | SUPERFAMILY | Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) | 10 | 64 | IPR036642 | GO:0005750|GO:0006122 |
Duplication type information
| Select | Gene | Chromosome | Start | End | Duplicated_type |
|---|---|---|---|---|---|
| Accr4g01302 | Accr-Chr4 | 12743596 | 12744459 | Wgd |
Functional genes information
| Select | Gene | Gene_start | Gene_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|
| Accr4g01302 | 1 | 72 | Chloroplast and Mitochondria Gene Families | AT5G05370 | 75.000 | 3.41e-39 | 122 |
Pathway information
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Accr4g01302 | - | - | egr:120295259 | 139.813 |